3hyk/1/1:B/1:C

Sequences
>3hyk-a1-m1-cB (length=112) [Search sequence]
AIVGIGIDIIELNRIEKLDKFERILTENERNVAKGLKGSRLTEFVAGRFAAKEAYSKAVG
TGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHSKEFAVAQVVLESS
>3hyk-a1-m1-cC (length=113) [Search sequence]
AIVGIGIDIIELNRIEKLDKFERILTENERNVAKGLKGSRLTEFVAGRFAAKEAYSKAVG
TGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHSKEFAVAQVVLESSS
Structure information
PDB ID 3hyk (database links: RCSB PDB PDBe PDBj PDBsum)
Title 2.31 Angstrom resolution crystal structure of a holo-(acyl-carrier-protein) synthase from Bacillus anthracis str. Ames in complex with CoA (3',5'-ADP)
Assembly ID 1
Resolution 2.31Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
PubMed citation 22993090
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q81JG3 Q81JG3
Species 1392 (Bacillus anthracis) 1392 (Bacillus anthracis)
Function annotation BioLiP:3hykB BioLiP:3hykC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3hyk-a1-m1-cB_3hyk-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3hyk-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3hyk/1/1:B/1:A 3hyk/1/1:C/1:A

[Back to Home]