3i84/2/2:A/2:B

Sequences

>3i84-a2-m2-cA (length=79) [Search sequence]

GTVFTTVEDLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGE YSCVFLPEPMGTANIQLHG

>3i84-a2-m2-cB (length=85) [Search sequence]

LLGTHGGTVFTTVEDLGSKILLTCSLDDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVD SDDQWGEYSCVFLPEPMGTANIQLH

Structure information

PDB ID	3i84 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The Crystal Structure of Human EMMPRIN N-terminal Domain 1 in P6(1)22 space group
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	119
Sequence identity between the two chains	0.987

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	P35613	P35613
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3i84-a2-m2-cA_3i84-a2-m2-cB.pdb.gz

Full biological assembly Download: 3i84-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3i84/1/1:A/1:B 3i84/2/1:A/1:B
Other dimers with similar sequences but different poses	3i84/2/1:B/2:B 3i84/2/1:A/2:A 3i84/2/1:A/2:B 3i84/2/2:A/1:B