3im4/1/1:B/1:A

Sequences

>3im4-a1-m1-cB (length=49) [Search sequence]

SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEA

>3im4-a1-m1-cA (length=50) [Search sequence]

SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK

Structure information

PDB ID	3im4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in complex with dual-specific A-Kinase Anchoring Protein 2
Assembly ID	1
Resolution	2.285Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	70
Sequence identity between the two chains	1.0
PubMed citation	20159461

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P00514	P00514
Species	9913 (Bos taurus)	9913 (Bos taurus)
Function annotation	BioLiP:3im4B	BioLiP:3im4A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3im4-a1-m1-cB_3im4-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3im4-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3im3/1/1:A/2:A 5hvz/1/1:B/1:A