3iwd/1/1:B/1:D

Sequences
>3iwd-a1-m1-cB (length=61) [Search sequence]
KSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVIS
E
>3iwd-a1-m1-cD (length=61) [Search sequence]
KSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVIS
E
Structure information
PDB ID 3iwd (database links: RCSB PDB PDBe PDBj PDBsum)
Title T. maritima AdoMetDC complex with 5'-Deoxy-5'-dimethyl thioadenosine
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
PubMed citation 20124698
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession Q9WZC3 Q9WZC3
Species 2336 (Thermotoga maritima) 2336 (Thermotoga maritima)
Function annotation BioLiP:3iwdB BioLiP:3iwdD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3iwd-a1-m1-cB_3iwd-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3iwd-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3iwb/1/1:B/1:D 3iwc/1/1:B/1:D
Other dimers with similar sequences but different poses
  • 1tlu/1/1:A/1:B 1tmi/1/1:A/1:B 1vr7/1/1:B/1:A 3iwb/1/1:A/1:C 3iwc/1/1:C/1:A 3iwd/1/1:A/1:C
  • [Back to Home]