3k9r/4/2:D/1:B

Sequences

>3k9r-a4-m2-cD (length=95) [Search sequence]

DAHVLKSRLEPAFTILDVRDRSTYNDGHIGAAPIEDLVDRASSSLEKSRDIYVYGAGDEQ TSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPTEL

>3k9r-a4-m1-cB (length=98) [Search sequence]

DAHVLKSRLEWGEPAFTILDVRDRSTYNDGHIGAAPIEDLVDRASSSLEKSRDIYVYGAG DEQTSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPTEL

Structure information

PDB ID	3k9r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-ray structure of the Rhodanese-like domain of the Alr3790 protein from Anabaena sp. Northeast Structural Genomics Consortium Target NsR437c.
Assembly ID	4
Resolution	1.96Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	D	B
UniProt accession	Q8YQN0	Q8YQN0
Species	103690 (Nostoc sp. PCC 7120 = FACHB-418)	103690 (Nostoc sp. PCC 7120 = FACHB-418)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3k9r-a4-m2-cD_3k9r-a4-m1-cB.pdb.gz

Full biological assembly Download: 3k9r-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3k9r/1/1:A/2:C 3k9r/1/2:D/1:B 3k9r/3/1:A/2:C
Other dimers with similar sequences but different poses	3hix/5/1:C/3:C 3hix/4/1:A/2:B 3ilm/2/1:D/1:C 3ilm/1/1:A/1:B 3k9r/5/1:D/1:C 3k9r/1/1:A/1:B 3k9r/1/2:D/2:C 3k9r/2/1:A/1:B