3kfd/3/1:C/1:D

Sequences

>3kfd-a3-m1-cC (length=112) [Search sequence]

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

>3kfd-a3-m1-cD (length=112) [Search sequence]

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Structure information

PDB ID	3kfd (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily
Assembly ID	3
Resolution	2.995Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	83
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	P01137	P01137
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3kfd-a3-m1-cC_3kfd-a3-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3kfd-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1kla/1/1:A/1:B 1klc/1/1:A/1:B 1kld/1/1:A/1:B 3kfd/1/1:A/1:B 3kfd/2/1:C/1:D 3kfd/3/1:A/1:B 4kv5/1/1:C/1:D 4kv5/2/1:A/1:B
Other dimers with similar sequences but different poses	3rjr/2/1:D/1:C 3rjr/1/1:B/1:A 5vqf/1/1:B/1:A 5vqf/2/1:D/1:C 6gff/1/1:D/1:B 6gff/2/1:H/1:F