3lo3/1/1:A/1:B

Sequences

>3lo3-a1-m1-cA (length=93) [Search sequence]

SNATAYIIVGLTPKDAEKLQQYGARVASTLAKYSGEVLVKGSVEQLHGKFEHKAQVILEF PSREDAYNWYHSEEYQALISTRDLGDSQFQLIG

>3lo3-a1-m1-cB (length=93) [Search sequence]

SNATAYIIVGLTPKDAEKLQQYGARVASTLAKYSGEVLVKGSVEQLHGKFEHKAQVILEF PSREDAYNWYHSEEYQALISTRDLGDSQFQLIG

Structure information

PDB ID	3lo3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of a conserved functionally unknown protein from Colwellia psychrerythraea 34H.
Assembly ID	1
Resolution	2.383Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q484V4	Q484V4
Species	167879 (Colwellia psychrerythraea 34H)	167879 (Colwellia psychrerythraea 34H)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3lo3-a1-m1-cA_3lo3-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3lo3-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3lo3/10/1:U/1:V 3lo3/11/1:W/1:X 3lo3/12/1:Y/1:Z 3lo3/13/1:a/1:b 3lo3/14/1:O/1:P 3lo3/2/1:C/1:D 3lo3/3/1:E/1:F 3lo3/4/1:G/1:H 3lo3/5/1:I/1:J 3lo3/6/1:K/1:L 3lo3/7/1:M/1:N 3lo3/8/1:Q/1:R 3lo3/9/1:S/1:T