3mhx/1/1:B/1:A

Sequences

>3mhx-a1-m1-cB (length=81) [Search sequence]

AMTLSELPLHTSAVVESVQDLHANDAIARRLRELGFVKGEEVRMVAKGEPLLVQVGFTRF ALRISEAKRVVVDAASQERRA

>3mhx-a1-m1-cA (length=85) [Search sequence]

AMTLSELPLHTSAVVESVQDLHANDAIARRLRELGFVKGEEVRMVAKGPVGGEPLLVQVG FTRFALRISEAKRVVVDAASQERRA

Structure information

PDB ID	3mhx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Stenotrophomonas maltophilia FeoA complexed with Zinc: A Unique Procaryotic SH3 Domain Protein Possibly Acting as a Bacterial Ferrous Iron Transport Activating Factor
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0
PubMed citation	20516589

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	B2FQ63	B2FQ63
Species	522373 (Stenotrophomonas maltophilia K279a)	522373 (Stenotrophomonas maltophilia K279a)
Function annotation	BioLiP:3mhxB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3mhx-a1-m1-cB_3mhx-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3mhx-assembly1.cif.gz