3mup/1/1:B/1:D

Sequences
>3mup-a1-m1-cB (length=100) [Search sequence]
ISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGD
DPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
>3mup-a1-m1-cD (length=102) [Search sequence]
SISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLS
Structure information
PDB ID 3mup (database links: RCSB PDB PDBe PDBj PDBsum)
Title cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac037
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
PubMed citation 20954235
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession Q13490 Q13490
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3mupB BioLiP:3mupD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3mup-a1-m1-cB_3mup-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3mup-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3mup/1/1:A/1:C 4eb9/1/1:A/1:C 4eb9/2/1:B/1:D
Other dimers with similar sequences but different poses
  • 3mup/1/1:D/1:C 3mup/1/1:B/1:A
  • [Back to Home]