3np5/1/1:C/1:D

Sequences

>3np5-a1-m1-cC (length=88) [Search sequence]

EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLAD VTQQAGLVKSELEAQTGLQILQTGVGQR

>3np5-a1-m1-cD (length=89) [Search sequence]

EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLAD VTQQAGLVKSELEAQTGLQILQTGVGQRE

Structure information

PDB ID	3np5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of an abridged form of the mature ectodomain of the human receptor-type protein tyrosine phosphatase ICA512/IA-2 AT pH 4.5
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	39
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q16849	Q16849
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3np5D

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3np5-a1-m1-cC_3np5-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3np5-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3n01/1/1:B/1:A 2qt7/1/1:A/1:B 2qt7/1/2:A/2:B 2qt7/2/1:A/1:B 3n4w/1/1:B/1:A 3ng8/1/1:A/1:B 3n01/2/1:B/2:A 2qt7/1/1:A/2:B 3n4w/2/2:B/1:A 3ng8/2/1:B/2:A 3np5/2/1:A/2:C 3np5/3/1:B/3:D 3np5/1/1:B/1:D 3np5/1/1:A/1:C