3nr6/2/2:B/4:B

Sequences

>3nr6-a2-m2-cB (length=114) [Search sequence]

TLGDQPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQNPGPLSDKSAWVGKRYRWTTDRKV HLATGKVTHSFLHVPDCPYPLLGRDLLTKLKAQIHFEGSGAQVVGPMGQPLQVL

>3nr6-a2-m4-cB (length=114) [Search sequence]

TLGDQPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQNPGPLSDKSAWVGKRYRWTTDRKV HLATGKVTHSFLHVPDCPYPLLGRDLLTKLKAQIHFEGSGAQVVGPMGQPLQVL

Structure information

PDB ID	3nr6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of xenotropic murine leukemia virus-related virus (XMRV) protease
Assembly ID	2
Resolution	1.97Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	21
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	4
Chain ID	B	B
UniProt accession	A1Z651	A1Z651
Species	373193 (Xenotropic MuLV-related virus VP62)	373193 (Xenotropic MuLV-related virus VP62)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3nr6-a2-m2-cB_3nr6-a2-m4-cB.pdb.gz

Full biological assembly Download: 3nr6-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3nr6/2/1:A/3:A 3nr6/2/1:A/4:A 3nr6/2/1:B/3:B 3nr6/2/1:B/4:B 3nr6/2/2:A/3:A 3nr6/2/2:A/4:A 3nr6/2/2:B/3:B
Other dimers with similar sequences but different poses	3nr6/2/4:B/4:A 3nr6/1/1:B/1:A 3nr6/2/1:B/1:A 3nr6/2/2:B/2:A 3nr6/2/3:B/3:A 3slz/1/1:A/1:B 3sm1/1/1:B/1:A 3sm1/1/1:J/1:B 3sm1/1/1:M/1:A 3sm2/1/1:A/1:B 4exh/1/1:B/1:A 4exh/1/1:J/1:B 4exh/1/1:M/1:A 4exh/2/1:B/1:A