3o27/1/1:B/1:A

Sequences

>3o27-a1-m1-cB (length=57) [Search sequence]

GIRKLVVLNPRATFYLLIPKDIAEALDIKPDDTFILNMEQKDGDIVLSYKRVKELKI

>3o27-a1-m1-cA (length=60) [Search sequence]

GIRKLVVLNPRAYHTTFYLLIPKDIAEALDIKPDDTFILNMEQKDGDIVLSYKRVKELKI

Structure information

PDB ID	3o27 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of C68 from the hybrid virus-plasmid pSSVx
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	143
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q9P9J8	Q9P9J8
Species	43080 (Sulfolobus islandicus)	43080 (Sulfolobus islandicus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3o27-a1-m1-cB_3o27-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3o27-assembly1.cif.gz