3ol0/1/1:B/1:C

Sequences

>3ol0-a1-m1-cB (length=41) [Search sequence]

HPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEG

>3ol0-a1-m1-cC (length=41) [Search sequence]

HPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEG

Structure information

PDB ID	3ol0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Monofoil-4P homo-trimer: de novo designed monomer trefoil-fold sub-domain which forms homo-trimer assembly
Assembly ID	1
Resolution	1.483Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	55
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession
Species	32630 (synthetic construct)	32630 (synthetic construct)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3ol0-a1-m1-cB_3ol0-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3ol0-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3ogf/1/1:C/1:B 3ol0/1/1:B/1:A 3ol0/1/1:C/1:A