3pf6/2/1:C/1:B

Sequences

>3pf6-a2-m1-cC (length=53) [Search sequence]

SQFQEVRPVAQALYPTHPSTKDALEEARLLFPGGTHHDFRALGYHNTLVKVEE

>3pf6-a2-m1-cB (length=55) [Search sequence]

GSQFQEVRPVAQALYPTHPSTKDALEEARLLFPGGTHHDFRALGYHNTLVKVEEQ

Structure information

PDB ID	3pf6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of uncharacterized protein PP-LUZ7_gp033 from Pseudomonas phage LUZ7.
Assembly ID	2
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	148
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	C8ZKC7	C8ZKC7
Species	655097 (Pseudomonas phage LUZ7)	655097 (Pseudomonas phage LUZ7)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3pf6-a2-m1-cC_3pf6-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3pf6-assembly2.cif.gz

Similar dimers