3plx/1/2:B/4:B

Sequences

>3plx-a1-m2-cB (length=100) [Search sequence]

ISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVI IMSYADFNEEEAKTFKPKVVFVDENNTATKITNYEKHGAI

>3plx-a1-m4-cB (length=100) [Search sequence]

ISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVI IMSYADFNEEEAKTFKPKVVFVDENNTATKITNYEKHGAI

Structure information

PDB ID	3plx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of aspartate alpha-decarboxylase from Campylobacter jejuni subsp. jejuni NCTC 11168
Assembly ID	1
Resolution	1.747Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	44
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	2	4
Chain ID	B	B
UniProt accession	Q9PIK3	Q9PIK3
Species	192222 (Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819)	192222 (Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819)
Function annotation	BioLiP:3plxB	BioLiP:3plxB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3plx-a1-m2-cB_3plx-a1-m4-cB.pdb.gz

Full biological assembly Download: 3plx-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3plx/1/1:B/3:B 3plx/1/1:B/4:B 3plx/1/2:B/3:B