3qte/6/1:C/2:D

Sequences

>3qte-a6-m1-cC (length=32) [Search sequence]

AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL

>3qte-a6-m2-cD (length=32) [Search sequence]

AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL

Structure information

PDB ID	3qte (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human alpha-defensin 6 (H27W mutant)
Assembly ID	6
Resolution	1.949Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	20
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	C	D
UniProt accession	Q01524	Q01524
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3qte-a6-m1-cC_3qte-a6-m2-cD.pdb.gz

Full biological assembly Download: 3qte-assembly6.cif.gz

Similar dimers