3qte/6/1:C/2:D

Sequences
>3qte-a6-m1-cC (length=32) [Search sequence]
AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL
>3qte-a6-m2-cD (length=32) [Search sequence]
AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL
Structure information
PDB ID 3qte (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human alpha-defensin 6 (H27W mutant)
Assembly ID 6
Resolution 1.949Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C D
UniProt accession Q01524 Q01524
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3qte-a6-m1-cC_3qte-a6-m2-cD.pdb.gz
Full biological assembly
Download: 3qte-assembly6.cif.gz
Similar dimers

[Back to Home]