3r3t/1/2:B/1:A

Sequences
>3r3t-a1-m2-cB (length=91) [Search sequence]
RKYEIYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYIL
NVNANAEAINEFDRLAKINEDILRHIVVKEE
>3r3t-a1-m1-cA (length=92) [Search sequence]
ARKYEIYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYI
LNVNANAEAINEFDRLAKINEDILRHIVVKEE
Structure information
PDB ID 3r3t (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of 30S Ribosomal Protein S from Bacillus anthracis
Assembly ID 1
Resolution 2.302Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 302
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession Q81JI2 Q81JI2
Species 260799 (Bacillus anthracis str. Sterne) 260799 (Bacillus anthracis str. Sterne)
Function annotation BioLiP:3r3tB BioLiP:3r3tA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3r3t-a1-m2-cB_3r3t-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3r3t-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3r3t/1/1:B/2:B 3r3t/1/1:A/2:A
  • [Back to Home]