3t97/1/1:C/1:A

Sequences

>3t97-a1-m1-cC (length=54) [Search sequence]

WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESV

>3t97-a1-m1-cA (length=56) [Search sequence]

WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKE

Structure information

PDB ID	3t97 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Molecular Architecture of the Transport Channel of the Nuclear Pore Complex: Nup62/Nup54
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	57
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	P17955	P17955
Species	10116 (Rattus norvegicus)	10116 (Rattus norvegicus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3t97-a1-m1-cC_3t97-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3t97-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5h1x/1/1:C/1:A 5h1x/1/1:C/1:B