3ta2/2/4:B/5:B

Sequences

>3ta2-a2-m4-cB (length=109) [Search sequence]

MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLQFRGREVEVDLLQKTK VEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEV

>3ta2-a2-m5-cB (length=109) [Search sequence]

MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLQFRGREVEVDLLQKTK VEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEV

Structure information

PDB ID	3ta2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	A. fulgidus GlnK3, MgATP/2-OG complex
Assembly ID	2
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	1.0
PubMed citation	22039461

Chain information

	Chain 1	Chain 2
Model ID	4	5
Chain ID	B	B
UniProt accession	O28524	O28524
Species	224325 (Archaeoglobus fulgidus DSM 4304)	224325 (Archaeoglobus fulgidus DSM 4304)
Function annotation	BioLiP:3ta2B	BioLiP:3ta2B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3ta2-a2-m4-cB_3ta2-a2-m5-cB.pdb.gz

Full biological assembly Download: 3ta2-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3o8w/1/1:A/2:A 3o8w/1/1:A/3:A 3o8w/1/2:A/3:A 3ta1/1/1:A/1:D 3ta1/1/1:C/1:A 3ta1/1/1:C/1:D 3ta1/2/1:B/1:F 3ta1/2/1:E/1:B 3ta1/2/1:E/1:F 3ta2/1/1:A/2:A 3ta2/1/1:A/3:A 3ta2/1/2:A/3:A 3ta2/2/1:B/4:B 3ta2/2/1:B/5:B 3ta2/3/1:C/6:C 3ta2/3/1:C/7:C 3ta2/3/6:C/7:C