3td3/3/1:E/1:H

Sequences

>3td3-a3-m1-cE (length=120) [Search sequence]

MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLN ERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR

>3td3-a3-m1-cH (length=121) [Search sequence]

HMELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKL NERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGS R

Structure information

PDB ID	3td3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of OmpA-like domain from Acinetobacter baumannii in complex with glycine
Assembly ID	3
Resolution	1.59Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	53
Sequence identity between the two chains	1.0
PubMed citation	21965596

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	H
UniProt accession	Q6RYW5	Q6RYW5
Species	470 (Acinetobacter baumannii)	470 (Acinetobacter baumannii)
Function annotation	BioLiP:3td3E	BioLiP:3td3H

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3td3-a3-m1-cE_3td3-a3-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3td3-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3td3/1/1:A/1:C 3td3/2/1:B/1:D 3td3/4/1:F/1:G 3td4/1/1:C/1:A 3td4/2/1:D/1:B 3td4/3/1:E/1:H 3td4/4/1:F/1:G 3td5/1/1:A/1:B 3td5/2/1:C/1:D 3td5/3/1:E/1:F 3td5/4/1:G/1:H 4g4y/1/1:A/1:C 4g4y/2/1:B/1:D 4g4y/3/1:E/1:H 4g4y/4/1:F/1:G 4g4z/1/1:C/1:A 4g4z/2/1:B/1:D 4g4z/3/1:E/1:H 4g4z/4/1:F/1:G 4g88/1/1:C/1:A 4g88/2/1:B/1:D 4g88/3/1:E/1:H 4g88/4/1:F/1:G