3v1d/4/1:E/1:H

Sequences

>3v1d-a4-m1-cE (length=48) [Search sequence]

GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD

>3v1d-a4-m1-cH (length=48) [Search sequence]

GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD

Structure information

PDB ID	3v1d (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of de novo designed MID1-cobalt
Assembly ID	4
Resolution	1.239Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	22
Sequence identity between the two chains	1.0
PubMed citation	22092237

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	H
UniProt accession
Species	32630 (synthetic construct)	32630 (synthetic construct)
Function annotation	BioLiP:3v1dE	BioLiP:3v1dH

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3v1d-a4-m1-cE_3v1d-a4-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3v1d-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3v1d/1/1:A/1:F 3v1d/2/1:B/1:C 3v1d/3/1:D/1:G 3v1f/1/1:B/1:A