3zbj/1/1:M/1:N

Sequences

>3zbj-a1-m1-cM (length=112) [Search sequence]

LEVGRNSPYDYRIKSVVYNPVNVVKIDAVAGVATHIVVAPDETYITHAFGDSESRTFAHK MNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIET

>3zbj-a1-m1-cN (length=112) [Search sequence]

LEVGRNSPYDYRIKSVVYNPVNVVKIDAVAGVATHIVVAPDETYITHAFGDSESRTFAHK MNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIET

Structure information

PDB ID	3zbj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Fitting results in the I-layer of the subnanometer structure of the bacterial pKM101 type IV secretion system core complex digested with elastase
Assembly ID	1
Resolution	8.5Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	59
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	M	N
UniProt accession	Q46704	Q46704
Species	511693 (Escherichia coli BL21)	511693 (Escherichia coli BL21)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3zbj-a1-m1-cM_3zbj-a1-m1-cN.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3zbj-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2ypw/1/1:A/1:B 2ypw/1/1:A/1:N 2ypw/1/1:B/1:C 2ypw/1/1:C/1:D 2ypw/1/1:D/1:E 2ypw/1/1:E/1:F 2ypw/1/1:F/1:G 2ypw/1/1:G/1:H 2ypw/1/1:H/1:I 2ypw/1/1:I/1:J 2ypw/1/1:J/1:K 2ypw/1/1:K/1:L 2ypw/1/1:L/1:M 2ypw/1/1:M/1:N 3zbj/1/1:A/1:B 3zbj/1/1:A/1:N 3zbj/1/1:B/1:C 3zbj/1/1:C/1:D 3zbj/1/1:D/1:E 3zbj/1/1:E/1:F 3zbj/1/1:F/1:G 3zbj/1/1:G/1:H 3zbj/1/1:H/1:I 3zbj/1/1:I/1:J 3zbj/1/1:J/1:K 3zbj/1/1:K/1:L 3zbj/1/1:L/1:M