3zbj/1/1:M/1:N

Sequences
>3zbj-a1-m1-cM (length=112) [Search sequence]
LEVGRNSPYDYRIKSVVYNPVNVVKIDAVAGVATHIVVAPDETYITHAFGDSESRTFAHK
MNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIET
>3zbj-a1-m1-cN (length=112) [Search sequence]
LEVGRNSPYDYRIKSVVYNPVNVVKIDAVAGVATHIVVAPDETYITHAFGDSESRTFAHK
MNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIET
Structure information
PDB ID 3zbj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Fitting results in the I-layer of the subnanometer structure of the bacterial pKM101 type IV secretion system core complex digested with elastase
Assembly ID 1
Resolution 8.5Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 59
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID M N
UniProt accession Q46704 Q46704
Species 511693 (Escherichia coli BL21) 511693 (Escherichia coli BL21)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3zbj-a1-m1-cM_3zbj-a1-m1-cN.pdb.gz
Full biological assembly
Download: 3zbj-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2ypw/1/1:A/1:B 2ypw/1/1:A/1:N 2ypw/1/1:B/1:C 2ypw/1/1:C/1:D 2ypw/1/1:D/1:E 2ypw/1/1:E/1:F 2ypw/1/1:F/1:G 2ypw/1/1:G/1:H 2ypw/1/1:H/1:I 2ypw/1/1:I/1:J 2ypw/1/1:J/1:K 2ypw/1/1:K/1:L 2ypw/1/1:L/1:M 2ypw/1/1:M/1:N 3zbj/1/1:A/1:B 3zbj/1/1:A/1:N 3zbj/1/1:B/1:C 3zbj/1/1:C/1:D 3zbj/1/1:D/1:E 3zbj/1/1:E/1:F 3zbj/1/1:F/1:G 3zbj/1/1:G/1:H 3zbj/1/1:H/1:I 3zbj/1/1:I/1:J 3zbj/1/1:J/1:K 3zbj/1/1:K/1:L 3zbj/1/1:L/1:M

[Back to Home]