3zhd/1/3:A/3:B

Sequences

>3zhd-a1-m3-cA (length=119) [Search sequence]

EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGPEVVSLISGSGGSTWY DDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSS

>3zhd-a1-m3-cB (length=119) [Search sequence]

EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGPEVVSLISGSGGSTWY DDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHAPSTEAPDYWGQGTLVTVSS

Structure information

PDB ID	3zhd (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of single domain antibody 8-4 scaffold.
Assembly ID	1
Resolution	1.962Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	20
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	A	B
UniProt accession	P01764	P01764
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3zhd-a1-m3-cA_3zhd-a1-m3-cB.pdb.gz

Full biological assembly Download: 3zhd-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3zhd/1/1:A/1:B 3zhd/1/2:A/2:B 3zhk/1/1:A/1:B
Other dimers with similar sequences but different poses	3zhd/1/2:B/3:B 3zhd/1/1:A/2:A 3zhd/1/1:A/3:A 3zhd/1/1:B/2:B 3zhd/1/1:B/3:B 3zhd/1/2:A/3:A 3zhd/1/1:A/3:B 3zhd/1/1:B/2:A 3zhd/1/2:B/3:A