4a5k/1/1:C/1:D

Sequences
>4a5k-a1-m1-cC (length=113) [Search sequence]
FTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHS
RKNSTSSSTGSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS
>4a5k-a1-m1-cD (length=114) [Search sequence]
PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEH
SRKNSTSNSTGSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS
Structure information
PDB ID 4a5k (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural analyses of Slm1-PH domain demonstrate ligand binding in the non-canonical site
Assembly ID 1
Resolution 1.76Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 0.991
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P40485 P40485
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4a5k-a1-m1-cC_4a5k-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4a5k-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4a5k/1/1:A/1:B 4a5k/1/1:C/1:B 4a5k/1/1:D/1:A
Other dimers with similar sequences but different poses
  • 4a6h/1/1:D/1:B 4a6h/1/1:C/1:A 4a6k/1/1:D/1:B
  • 4a6h/1/1:D/1:A 4a6h/1/1:C/1:B 4a6k/1/1:D/1:A
  • 4a6h/1/1:A/1:B 4a6k/1/1:A/1:B
  • [Back to Home]