4a5k/1/1:C/1:D

Sequences

>4a5k-a1-m1-cC (length=113) [Search sequence]

FTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHS RKNSTSSSTGSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS

>4a5k-a1-m1-cD (length=114) [Search sequence]

PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEH SRKNSTSNSTGSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS

Structure information

PDB ID	4a5k (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural analyses of Slm1-PH domain demonstrate ligand binding in the non-canonical site
Assembly ID	1
Resolution	1.76Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	33
Sequence identity between the two chains	0.991

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	P40485	P40485
Species	4932 (Saccharomyces cerevisiae)	4932 (Saccharomyces cerevisiae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4a5k-a1-m1-cC_4a5k-a1-m1-cD.pdb.gz

Full biological assembly Download: 4a5k-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4a5k/1/1:A/1:B 4a5k/1/1:C/1:B 4a5k/1/1:D/1:A
Other dimers with similar sequences but different poses	4a6h/1/1:D/1:B 4a6h/1/1:C/1:A 4a6k/1/1:D/1:B 4a6h/1/1:D/1:A 4a6h/1/1:C/1:B 4a6k/1/1:D/1:A 4a6h/1/1:A/1:B 4a6k/1/1:A/1:B