4a6h/1/1:D/1:A

Sequences

>4a6h-a1-m1-cD (length=106) [Search sequence]

PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEH SRKSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS

>4a6h-a1-m1-cA (length=108) [Search sequence]

HPFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTE HSRKNSDAKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTS

Structure information

PDB ID	4a6h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Slm1-PH domain in complex with Inositol-4- phosphate
Assembly ID	1
Resolution	1.449Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	17
Sequence identity between the two chains	1.0
PubMed citation	22574179

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	P40485	P40485
Species	4932 (Saccharomyces cerevisiae)	4932 (Saccharomyces cerevisiae)
Function annotation	BioLiP:4a6hD	BioLiP:4a6hA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4a6h-a1-m1-cD_4a6h-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4a6h-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4a6h/1/1:C/1:B 4a6k/1/1:D/1:A
Other dimers with similar sequences but different poses	4a5k/1/1:C/1:D 4a5k/1/1:A/1:B 4a5k/1/1:C/1:B 4a5k/1/1:D/1:A 4a6h/1/1:D/1:B 4a6h/1/1:C/1:A 4a6k/1/1:D/1:B 4a6h/1/1:A/1:B 4a6k/1/1:A/1:B