4adz/1/2:A/2:B

Sequences

>4adz-a1-m2-cA (length=90) [Search sequence]

YHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHLRH CVADAALKGGTEIDAKVEEATKAIGRLLRT

>4adz-a1-m2-cB (length=90) [Search sequence]

YHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHLRH CVADAALKGGTEIDAKVEEATKAIGRLLRT

Structure information

PDB ID	4adz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the apo form of a Copper-sensitive operon Regulator (CsoR) protein from Streptomyces lividans
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	76
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	D6EK73	D6EK73
Species	1916 (Streptomyces lividans)	1916 (Streptomyces lividans)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4adz-a1-m2-cA_4adz-a1-m2-cB.pdb.gz

Full biological assembly Download: 4adz-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4adz/1/1:A/1:B 4uig/1/1:A/4:A 4uig/1/2:A/3:A
Other dimers with similar sequences but different poses	4uig/1/3:A/4:A 4adz/1/1:A/2:A 4adz/1/1:B/2:B 4uig/1/1:A/2:A