4alp/1/4:D/2:B

Sequences

>4alp-a1-m4-cD (length=84) [Search sequence]

VLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFT FKKSSKGFESLRVTGPGGNPCLGN

>4alp-a1-m2-cB (length=86) [Search sequence]

QVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEF TFKKSSKGFESLRVTGPGGNPCLGNE

Structure information

PDB ID	4alp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The Lin28b Cold shock domain in complex with hexauridine
Assembly ID	1
Resolution	1.48Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0
PubMed citation	22570413

Chain information

	Chain 1	Chain 2
Model ID	4	2
Chain ID	D	B
UniProt accession	B4F6I0	B4F6I0
Species	8364 (Xenopus tropicalis)	8364 (Xenopus tropicalis)
Function annotation	BioLiP:4alpD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4alp-a1-m4-cD_4alp-a1-m2-cB.pdb.gz

Full biological assembly Download: 4alp-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4alp/1/1:C/1:A 4alp/1/1:D/1:B 4alp/1/2:C/4:A
Other dimers with similar sequences but different poses	3ulj/3/2:A/2:B 3ulj/3/1:A/1:B 3ulj/3/1:A/2:B 3ulj/3/2:A/1:B