4dky/1/1:A/2:A

Sequences

>4dky-a1-m1-cA (length=97) [Search sequence]

MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVA RNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPA

>4dky-a1-m2-cA (length=97) [Search sequence]

MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVA RNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPA

Structure information

PDB ID	4dky (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure Analysis of N terminal region containing the dimerization domain and DNA binding domain of HU protein(Histone like protein-DNA binding) from Mycobacterium tuberculosis [H37Rv]
Assembly ID	1
Resolution	2.478Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	131
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	A5U6Z7	A5U6Z7
Species	1773 (Mycobacterium tuberculosis)	1773 (Mycobacterium tuberculosis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4dky-a1-m1-cA_4dky-a1-m2-cA.pdb.gz

Full biological assembly Download: 4dky-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4dky/2/1:B/3:B 4pt4/1/1:B/1:A