4dky/1/1:A/2:A

Sequences
>4dky-a1-m1-cA (length=97) [Search sequence]
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVA
RNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPA
>4dky-a1-m2-cA (length=97) [Search sequence]
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVA
RNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPA
Structure information
PDB ID 4dky (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure Analysis of N terminal region containing the dimerization domain and DNA binding domain of HU protein(Histone like protein-DNA binding) from Mycobacterium tuberculosis [H37Rv]
Assembly ID 1
Resolution 2.478Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 131
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession A5U6Z7 A5U6Z7
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4dky-a1-m1-cA_4dky-a1-m2-cA.pdb.gz
Full biological assembly
Download: 4dky-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4dky/2/1:B/3:B 4pt4/1/1:B/1:A

[Back to Home]