4fdx/1/3:A/3:B

Sequences

>4fdx-a1-m3-cA (length=61) [Search sequence]

PIIQMNLLEGRTVEQKRNAVAAITEAVVRTLDVRPDQVRILINELGVEHFSVAGQTAAMR Q

>4fdx-a1-m3-cB (length=64) [Search sequence]

PIIQMNLLEGRTVEQKRNAVAAITEAVVRTLDVRPDQVRILINELGVEHFSVAGQTAAMR QAAA

Structure information

PDB ID	4fdx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Kinetic and structural characterization of the 4-oxalocrotonate tautomerase isozymes from Methylibium petroleiphilum
Assembly ID	1
Resolution	1.64Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	64
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	A	B
UniProt accession	A2SL37	A2SL37
Species	420662 (Methylibium petroleiphilum PM1)	420662 (Methylibium petroleiphilum PM1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4fdx-a1-m3-cA_4fdx-a1-m3-cB.pdb.gz

Full biological assembly Download: 4fdx-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4fdx/1/1:A/1:B 4fdx/1/2:A/2:B
Other dimers with similar sequences but different poses	4fdx/1/2:B/3:B 4fdx/1/1:A/2:A 4fdx/1/1:A/3:A 4fdx/1/1:B/2:B 4fdx/1/1:B/3:B 4fdx/1/2:A/3:A