4lhx/2/1:D/1:C

Sequences

>4lhx-a2-m1-cD (length=71) [Search sequence]

GYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQA TAEKQLKEAQG

>4lhx-a2-m1-cC (length=72) [Search sequence]

GYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQA TAEKQLKEAQGK

Structure information

PDB ID	4lhx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of nucleotide-free Rab8:Rabin8
Assembly ID	2
Resolution	3.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	111
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q96QF0	Q96QF0
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4lhx-a2-m1-cD_4lhx-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4lhx-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4lhx/1/1:E/1:F 4lhy/1/1:E/1:F 4lhy/2/1:D/1:C 4lhz/1/1:E/1:F 4lhz/2/1:D/1:C
Other dimers with similar sequences but different poses	6f6p/1/1:C/1:D 6f6p/1/1:B/1:A 6f6p/1/1:B/1:D 6f6p/1/1:C/1:A