4n0a/1/1:A/2:B

Sequences
>4n0a-a1-m1-cA (length=80) [Search sequence]
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESE
RRCEMVFIRGDTVTLISTPS
>4n0a-a1-m2-cB (length=80) [Search sequence]
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESE
RRCEMVFIRGDTVTLISTPS
Structure information
PDB ID 4n0a (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Lsm2-3-Pat1C complex from Saccharomyces cerevisiae
Assembly ID 1
Resolution 3.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession P57743 P57743
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4n0a-a1-m1-cA_4n0a-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4n0a-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4m7a/3/1:C/1:J 4n0a/1/1:B/2:A
Other dimers with similar sequences but different poses
  • 3bw1/1/4:A/4:B 3bw1/1/1:A/1:B 3bw1/1/1:A/3:B 3bw1/1/1:B/4:A 3bw1/1/2:A/2:B 3bw1/1/2:A/4:B 3bw1/1/2:B/3:A 3bw1/1/3:A/3:B
  • [Back to Home]