4n0a/1/1:A/2:B

Sequences

>4n0a-a1-m1-cA (length=80) [Search sequence]

METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESE RRCEMVFIRGDTVTLISTPS

>4n0a-a1-m2-cB (length=80) [Search sequence]

METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESE RRCEMVFIRGDTVTLISTPS

Structure information

PDB ID	4n0a (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Lsm2-3-Pat1C complex from Saccharomyces cerevisiae
Assembly ID	1
Resolution	3.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	21
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	B
UniProt accession	P57743	P57743
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4n0a-a1-m1-cA_4n0a-a1-m2-cB.pdb.gz

Full biological assembly Download: 4n0a-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4m7a/3/1:C/1:J 4n0a/1/1:B/2:A
Other dimers with similar sequences but different poses	3bw1/1/4:A/4:B 3bw1/1/1:A/1:B 3bw1/1/1:A/3:B 3bw1/1/1:B/4:A 3bw1/1/2:A/2:B 3bw1/1/2:A/4:B 3bw1/1/2:B/3:A 3bw1/1/3:A/3:B