4pwa/2/3:B/3:D

Sequences
>4pwa-a2-m3-cB (length=86) [Search sequence]
EDKLALGREIFLERSEPQCALCHTLADAEAVGEVGPNLDELKPDAERVNTAVTNGIGPMP
ANEILTDEEIEAVALYVSTVAGKAKN
>4pwa-a2-m3-cD (length=87) [Search sequence]
EEDKLALGREIFLERSEPQCALCHTLADAEAVGEVGPNLDELKPDAERVNTAVTNGIGPM
PANEILTDEEIEAVALYVSTVAGKAKN
Structure information
PDB ID 4pwa (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the c-type cytochrome SorU from Sinorhizobium meliloti
Assembly ID 2
Resolution 2.19Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 40
Sequence identity between the two chains 1.0
PubMed citation 26687009
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID B D
UniProt accession Q92M25 Q92M25
Species 266834 (Sinorhizobium meliloti 1021) 266834 (Sinorhizobium meliloti 1021)
Function annotation BioLiP:4pwaB BioLiP:4pwaD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4pwa-a2-m3-cB_4pwa-a2-m3-cD.pdb.gz
Full biological assembly
Download: 4pwa-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4pwa/2/1:B/1:D 4pwa/2/1:B/3:D 4pwa/2/3:B/1:D

[Back to Home]