4qic/1/1:B/1:D

Sequences

>4qic-a1-m1-cB (length=51) [Search sequence]

NHFTFGDDLLGVNSEIARKLRQFYLEIQEEALPARLLELLERLEQAERFGL

>4qic-a1-m1-cD (length=54) [Search sequence]

NHFTFGDDLLGVNSEIARKLRQFYLEIQEEALPARLLELLERLEQAERFGLNNA

Structure information

PDB ID	4qic (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Co-Crystal Structure of Anti-anti-sigma factor PhyR complexed with Anti-sigma factor NepR from Bartonella quintana
Assembly ID	1
Resolution	2.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	A0A0H3LV19	A0A0H3LV19
Species	283165 (Bartonella quintana str. Toulouse)	283165 (Bartonella quintana str. Toulouse)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4qic-a1-m1-cB_4qic-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4qic-assembly1.cif.gz