4wk1/1/2:A/3:A

Sequences

>4wk1-a1-m2-cA (length=92) [Search sequence]

GLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDR VDEILSVINQTCGNEVGGATVFVMPVDAFHQF

>4wk1-a1-m3-cA (length=92) [Search sequence]

GLVPRGSHMKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDR VDEILSVINQTCGNEVGGATVFVMPVDAFHQF

Structure information

PDB ID	4wk1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Staphylococcus aureus PstA in complex with c-di-AMP
Assembly ID	1
Resolution	1.98Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	67
Sequence identity between the two chains	1.0
PubMed citation	25435171

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	A	A
UniProt accession	A0A0H2WXZ7	A0A0H2WXZ7
Species	93062 (Staphylococcus aureus subsp. aureus COL)	93062 (Staphylococcus aureus subsp. aureus COL)
Function annotation	BioLiP:4wk1A	BioLiP:4wk1A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4wk1-a1-m2-cA_4wk1-a1-m3-cA.pdb.gz

Full biological assembly Download: 4wk1-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4d3g/1/1:A/2:A 4d3g/1/1:A/3:A 4d3g/1/2:A/3:A 4wk1/1/1:A/2:A 4wk1/1/1:A/3:A 4wk3/1/1:A/2:A 4wk3/1/1:A/3:A 4wk3/1/2:A/3:A