4x3t/3/1:E/1:D

Sequences

>4x3t-a3-m1-cE (length=51) [Search sequence]

HMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVM

>4x3t-a3-m1-cD (length=62) [Search sequence]

HMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERD RA

Structure information

PDB ID	4x3t (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of chromobox homolog 7 (CBX7) chromodomain with MS37452
Assembly ID	3
Resolution	2.14Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	54
Sequence identity between the two chains	1.0
PubMed citation	25660273

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	D
UniProt accession	Q8VDS3	Q8VDS3
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:4x3tE	BioLiP:4x3tD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4x3t-a3-m1-cE_4x3t-a3-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4x3t-assembly3.cif.gz