4x3t/3/1:E/1:D

Sequences
>4x3t-a3-m1-cE (length=51) [Search sequence]
HMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVM
>4x3t-a3-m1-cD (length=62) [Search sequence]
HMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERD
RA
Structure information
PDB ID 4x3t (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of chromobox homolog 7 (CBX7) chromodomain with MS37452
Assembly ID 3
Resolution 2.14Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 54
Sequence identity between the two chains 1.0
PubMed citation 25660273
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E D
UniProt accession Q8VDS3 Q8VDS3
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:4x3tE BioLiP:4x3tD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4x3t-a3-m1-cE_4x3t-a3-m1-cD.pdb.gz
Full biological assembly
Download: 4x3t-assembly3.cif.gz

[Back to Home]