4xo1/1/1:A/2:A

Sequences

>4xo1-a1-m1-cA (length=55) [Search sequence]

NIEELKKQAETEIADFIAQKIAENKNTGKEVSERFTAREKTGLESYDVKIKILEH

>4xo1-a1-m2-cA (length=55) [Search sequence]

NIEELKKQAETEIADFIAQKIAENKNTGKEVSERFTAREKTGLESYDVKIKILEH

Structure information

PDB ID	4xo1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	crystal structure of Se-Met GnsA with double mutations
Assembly ID	1
Resolution	1.802Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	84
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	P0AC92	P0AC92
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4xo1-a1-m1-cA_4xo1-a1-m2-cA.pdb.gz

Full biological assembly Download: 4xo1-assembly1.cif.gz