5b52/1/1:A/1:B

Sequences

>5b52-a1-m1-cA (length=57) [Search sequence]

LAEFAAAEKALQEQMAQLEALKKDAGLKREIEFEQKLVGLMKSYDKSLRDIIAILDP

>5b52-a1-m1-cB (length=60) [Search sequence]

RLAEFAAAEKALQEQMAQLEALKKDAGLKREIEFEQKLVGLMKSYDKSLRDIIAILDPKL

Structure information

PDB ID	5b52 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the N-terminal domain of H-NS family protein TurB
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	44
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q88GF9	Q88GF9
Species	160488 (Pseudomonas putida KT2440)	160488 (Pseudomonas putida KT2440)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5b52-a1-m1-cA_5b52-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5b52-assembly1.cif.gz