5bu7/1/1:B/2:B

Sequences

>5bu7-a1-m1-cB (length=106) [Search sequence]

ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMHD FRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKCTCNACHQKYR

>5bu7-a1-m2-cB (length=106) [Search sequence]

ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMHD FRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKCTCNACHQKYR

Structure information

PDB ID	5bu7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of an engineered protein that forms nanotubes with tunable diameters
Assembly ID	1
Resolution	2.46Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	B	B
UniProt accession	P0ABE7	P0ABE7
Species	562 (Escherichia coli)	562 (Escherichia coli)
Function annotation	BioLiP:5bu7B	BioLiP:5bu7B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5bu7-a1-m1-cB_5bu7-a1-m2-cB.pdb.gz

Full biological assembly Download: 5bu7-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3tom/3/1:C/1:D 3tol/1/1:A/1:B 3tol/2/1:C/1:D 3tom/1/1:C/1:D 3tom/2/1:A/1:B 3tom/3/1:A/1:B 5bu7/1/1:A/1:B 5bu7/1/2:A/2:B 5bu7/1/1:A/2:B 5bu7/1/1:B/2:A