5efw/1/1:C/1:B

Sequences

>5efw-a1-m1-cC (length=49) [Search sequence]

TRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK

>5efw-a1-m1-cB (length=55) [Search sequence]

KFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK

Structure information

PDB ID	5efw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of LOV2-Zdk1 - the complex of oat LOV2 and the affibody protein Zdark1
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	46
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession
Species	1280 (Staphylococcus aureus)	1280 (Staphylococcus aureus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5efw-a1-m1-cC_5efw-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5efw-assembly1.cif.gz