5k89/2/1:H/3:H

Sequences

>5k89-a2-m1-cH (length=89) [Search sequence]

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLVDAVDKVMKELDEN GDGEVDFQEYVVLVAALTVACNNFFWENS

>5k89-a2-m3-cH (length=89) [Search sequence]

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLVDAVDKVMKELDEN GDGEVDFQEYVVLVAALTVACNNFFWENS

Structure information

PDB ID	5k89 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Human Calcium-Bound S100A1
Assembly ID	2
Resolution	2.249Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	84
Sequence identity between the two chains	1.0
PubMed citation	28368280

Chain information

	Chain 1	Chain 2
Model ID	1	3
Chain ID	H	H
UniProt accession	P23297	P23297
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5k89H	BioLiP:5k89H

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5k89-a2-m1-cH_5k89-a2-m3-cH.pdb.gz

Full biological assembly Download: 5k89-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1zfs/1/1:A/1:B 2k2f/1/1:A/1:B 2kbm/1/1:A/1:B 2lp2/1/1:A/1:B 2lp3/1/1:A/1:B 2lux/1/1:A/1:B
Other dimers with similar sequences but different poses	2llt/1/1:A/1:B 2l0p/1/1:A/1:B 2lhl/1/1:A/1:B 2lls/1/1:A/1:B 2llu/1/1:A/1:B 2m3w/1/1:A/1:B