5low/1/1:E/1:G

Sequences

>5low-a1-m1-cE (length=56) [Search sequence]

RENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQ

>5low-a1-m1-cG (length=60) [Search sequence]

FARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRA

Structure information

PDB ID	5low (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the Ca2+-bound Rabphilin 3A C2B domain SNAP25 complex (P21 space group)
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	65
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	G
UniProt accession	P60881	P60881
Species	10116 (Rattus norvegicus)	10116 (Rattus norvegicus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5low-a1-m1-cE_5low-a1-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5low-assembly1.cif.gz