5nnm/1/1:B/1:A

Sequences

>5nnm-a1-m1-cB (length=32) [Search sequence]

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLV

>5nnm-a1-m1-cA (length=34) [Search sequence]

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR

Structure information

PDB ID	5nnm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of dimeric LL-37
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	18
Sequence identity between the two chains	1.0
PubMed citation	29133814

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P49913	P49913
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5nnmA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5nnm-a1-m1-cB_5nnm-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5nnm-assembly1.cif.gz