5vjx/4/2:T/2:S

Sequences
>5vjx-a4-m2-cT (length=41) [Search sequence]
PEFSAQLGAQHLKDQLEQRTRIEANIHRQQEELRKIQEQLQ
>5vjx-a4-m2-cS (length=46) [Search sequence]
GADPEFSAQLGAQHLKDQLEQRTRIEANIHRQQEELRKIQEQLQVH
Structure information
PDB ID 5vjx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the CLOCK Transcription Domain Exon19 in Complex with a Repressor
Assembly ID 4
Resolution 2.695Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID T S
UniProt accession O08785 O08785
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5vjx-a4-m2-cT_5vjx-a4-m2-cS.pdb.gz
Full biological assembly
Download: 5vjx-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5vji/1/1:B/1:A 5vji/2/1:D/1:E 5vjx/1/1:c/1:b 5vjx/2/1:F/1:E 5vjx/2/1:K/1:L 5vjx/3/1:I/1:H 5vjx/3/1:V/1:W 5vjx/4/1:N/1:O 5vjx/5/1:e/1:f

[Back to Home]