6bjo/1/1:B/1:A

Sequences

>6bjo-a1-m1-cB (length=85) [Search sequence]

VPGKVTLQKDAQNLIGISIGGGAYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIK GKTKVEVAKMIQEVKGEVTIHYNKL

>6bjo-a1-m1-cA (length=86) [Search sequence]

VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSI KGKTKVEVAKMIQEVKGEVTIHYNKL

Structure information

PDB ID	6bjo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	PICK1 PDZ domain in complex with the small molecule inhibitor BIO124.
Assembly ID	1
Resolution	1.75Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	35
Sequence identity between the two chains	1.0
PubMed citation	29280296

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q9NRD5	Q9NRD5
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6bjoB	BioLiP:6bjoA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6bjo-a1-m1-cB_6bjo-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6bjo-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2gzv/2/1:A/2:A 6ar4/1/1:A/1:B 6bjn/1/1:A/1:B
Other dimers with similar sequences but different poses	3hpk/3/1:B/1:A 3hpm/3/1:A/1:B